PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000123873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 353aa    MW: 39750.9 Da    PI: 6.1859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000123873genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.86.9e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv++++q+G g+W++ ++  g++R++k+c++rw +yl
    MDP0000123873 14 KGPWTPEEDQKLVQYIEQHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.74.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W+tIa ++  gRt++++k++w+++l
    MDP0000123873  67 RGKFSEEEEQTILHLHSILGNK-WSTIATHLD-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.116961IPR017930Myb domain
SuperFamilySSF466891.1E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-161363IPR001005SANT/Myb domain
PfamPF002492.5E-181461IPR001005SANT/Myb domain
CDDcd001672.88E-131661No hitNo description
PROSITE profilePS5129426.9262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2665117IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLVQYIE QHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQTILH LHSILGNKWS TIATHLDGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRT DLFSNLSQLL ALANLQDLMQ QYQPLDHINQ HDATLHADQA VQLTKLQYIE  180
HLLQSVAYTS NNDTYTQNRS TEMEMDDQAF NLLSSINIPP SKETPNFNSL QLENPSSFSH  240
GYGGNSSQPL HHLQSLLPHD LADPQVAFSS LPSLNNSNHE VGQGSNFTVV RGQEKNPSDE  300
SSWFNNLVSP TASIPPTSNV PGDAYCSRSS YGGRSSDSSS YWPDLFLEDA NYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368426.10.0PREDICTED: protein ODORANT1-like
TrEMBLM5XKW70.0M5XKW7_PRUPE; Uncharacterized protein
STRINGGLYMA04G11040.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-93myb domain protein 93